PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca22412.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 417aa    MW: 47354 Da    PI: 6.5897
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca22412.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.92.9e-51121392128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 ppGfrFhPt+eel+++yL+kkv+++k++l +vi evd++k+ePwd+++k++     +++wyfFs++dkky+tg+r+nrat +g+Wkatg+dk ++s + 
  Dca22412.1  12 PPGFRFHPTEEELLQYYLRKKVANDKIDL-DVIFEVDLNKLEPWDIQEKCRIgttPQNDWYFFSHKDKKYPTGTRTNRATVAGFWKATGRDKVIYS-NC 108
                 9****************************.99**************964443122456**************************************.88 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 + +g++ktLvfykgrap+g+k+dW+mheyrl
  Dca22412.1 109 RRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 139
                 89***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.15E-568176IPR003441NAC domain
PROSITE profilePS5100555.46211176IPR003441NAC domain
PfamPF023652.6E-2712139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MNISVNGQSR IPPGFRFHPT EEELLQYYLR KKVANDKIDL DVIFEVDLNK LEPWDIQEKC  60
RIGTTPQNDW YFFSHKDKKY PTGTRTNRAT VAGFWKATGR DKVIYSNCRR IGMRKTLVFY  120
KGRAPHGQKS DWIMHEYRLD DCSNINDDIH VTSHAMNNNG DFTQEEGWVV CRIFKKKNHI  180
KTLDHHHNNN TSSINNNNNN NNNNNNNNEM SLLMESHSTM LDSPSDHDLD NDQGALEQIF  240
QSLGSKNNVF TRPSFNHRLD NSNSISNSIS MISNSSNNNK FMKLPSLESP NNSTTHLTTF  300
YHHPMHPEND VVSAANTSET DLGDWATLDR LVATHLNGHS TTDTTMSSIF STSSSSLSTS  360
AGCKIYNNII TNNNNNSDAL ENNYGSNNNN NEIIDLWSFT RSTLQIDPLC HVSDGGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-501117915171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010690154.11e-156PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-112NAC43_ARATH; NAC domain-containing protein 43
TrEMBLF6I2X71e-135F6I2X7_VITVI; Putative uncharacterized protein
STRINGVIT_15s0048g02660.t011e-134(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-105NAC family protein